PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vun003856
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family EIL
Protein Properties Length: 243aa    MW: 27862.7 Da    PI: 5.4714
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-167a-Vigna_unguiculata-7627PU_refplantGDBView CDS
gnl|UG|Vun#S45879151PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3353.73.7e-108492431201
                XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
       EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWWkekve 100
                +el+krmw+d++++krlke++k     ke  t+a k+++s+eqarrkkmsraQDgiLkYMlk+mevc+aqGfvYgiipekgkpv+gasd+Lr+WWk+kv+
  Vun003856  49 DELEKRMWRDKVRHKRLKEQQKA----KEG-TDAVKQRQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPEKGKPVTGASDNLREWWKDKVR 143
                79*******************97....787.9******************************************************************** PP

                XXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT--.-----GGG CS
       EIN3 101 fdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdqgtppykkphd 200
                fdrngpaai+kyqa+n+i+++++++++    ++h+l+elqDTtlgSLLsalmqhcdppqrrfplekgv+pPWWPtG e+ww++ gl+kdqg+ppykkphd
  Vun003856 144 FDRNGPAAIAKYQAENAIPGKNDGCNS-IGPTPHTLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGVPPPWWPTGYEEWWPQIGLPKDQGPPPYKKPHD 242
                *************************88.9*********************************************************************** PP

                - CS
       EIN3 201 l 201
                l
  Vun003856 243 L 243
                8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048735.1E-10249243No hitNo description
Gene3DG3DSA:1.10.3180.103.0E-38169243IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167682.75E-31175243IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MMMFEDIGFC GDLDLLSCPL GDEDIVAVRQ TDPDPVVEDD YSDEEIDMDE LEKRMWRDKV  60
RHKRLKEQQK AKEGTDAVKQ RQSQEQARRK KMSRAQDGIL KYMLKMMEVC KAQGFVYGII  120
PEKGKPVTGA SDNLREWWKD KVRFDRNGPA AIAKYQAENA IPGKNDGCNS IGPTPHTLQE  180
LQDTTLGSLL SALMQHCDPP QRRFPLEKGV PPPWWPTGYE EWWPQIGLPK DQGPPPYKKP  240
HDL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A7e-43174243271Protein ETHYLENE INSENSITIVE 3
4zds_B7e-43174243271Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001304225.11e-175ETHYLENE INSENSITIVE 3-like 1 protein
RefseqXP_014504860.11e-175PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein
SwissprotO246061e-145EIN3_ARATH; Protein ETHYLENE INSENSITIVE 3
TrEMBLA0A0L9UV141e-175A0A0L9UV14_PHAAN; Uncharacterized protein
TrEMBLA0A0S3RK721e-175A0A0S3RK72_PHAAN; Uncharacterized protein
STRINGGLYMA14G04550.11e-164(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20770.11e-146EIL family protein